Anti ZNF77 pAb (ATL-HPA023397)

Atlas Antibodies

Catalog No.:
ATL-HPA023397-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 77
Gene Name: ZNF77
Alternative Gene Name: pT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074194: 39%, ENSRNOG00000050600: 41%
Entrez Gene ID: 58492
Uniprot ID: Q15935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPCKECGQACSCLSCQSPPMKTQTVEKPCNCQDSRTASVTYVKSLSSKKSYECQKCGKAFICPSS
Gene Sequence RPCKECGQACSCLSCQSPPMKTQTVEKPCNCQDSRTASVTYVKSLSSKKSYECQKCGKAFICPSS
Gene ID - Mouse ENSMUSG00000074194
Gene ID - Rat ENSRNOG00000050600
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF77 pAb (ATL-HPA023397)
Datasheet Anti ZNF77 pAb (ATL-HPA023397) Datasheet (External Link)
Vendor Page Anti ZNF77 pAb (ATL-HPA023397) at Atlas Antibodies

Documents & Links for Anti ZNF77 pAb (ATL-HPA023397)
Datasheet Anti ZNF77 pAb (ATL-HPA023397) Datasheet (External Link)
Vendor Page Anti ZNF77 pAb (ATL-HPA023397)