Anti ZNF721 pAb (ATL-HPA065313)

Atlas Antibodies

Catalog No.:
ATL-HPA065313-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 721
Gene Name: ZNF721
Alternative Gene Name: KIAA1982
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044014: 33%, ENSRNOG00000014172: 33%
Entrez Gene ID: 170960
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLISSCRVISHGLSRGRNRATEKNDLLTTEEPVVKHRFDLQYPEEMWRNTVVQKGR
Gene Sequence SSLISSCRVISHGLSRGRNRATEKNDLLTTEEPVVKHRFDLQYPEEMWRNTVVQKGR
Gene ID - Mouse ENSMUSG00000044014
Gene ID - Rat ENSRNOG00000014172
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF721 pAb (ATL-HPA065313)
Datasheet Anti ZNF721 pAb (ATL-HPA065313) Datasheet (External Link)
Vendor Page Anti ZNF721 pAb (ATL-HPA065313) at Atlas Antibodies

Documents & Links for Anti ZNF721 pAb (ATL-HPA065313)
Datasheet Anti ZNF721 pAb (ATL-HPA065313) Datasheet (External Link)
Vendor Page Anti ZNF721 pAb (ATL-HPA065313)