Anti ZNF713 pAb (ATL-HPA059425)

Atlas Antibodies

SKU:
ATL-HPA059425-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 713
Gene Name: ZNF713
Alternative Gene Name: FLJ39963
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098022: 24%, ENSRNOG00000030750: 24%
Entrez Gene ID: 349075
Uniprot ID: Q8N859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHK
Gene Sequence LDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHK
Gene ID - Mouse ENSMUSG00000098022
Gene ID - Rat ENSRNOG00000030750
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF713 pAb (ATL-HPA059425)
Datasheet Anti ZNF713 pAb (ATL-HPA059425) Datasheet (External Link)
Vendor Page Anti ZNF713 pAb (ATL-HPA059425) at Atlas Antibodies

Documents & Links for Anti ZNF713 pAb (ATL-HPA059425)
Datasheet Anti ZNF713 pAb (ATL-HPA059425) Datasheet (External Link)
Vendor Page Anti ZNF713 pAb (ATL-HPA059425)