Anti ZNF704 pAb (ATL-HPA024285)

Atlas Antibodies

Catalog No.: ATL-HPA024285-100

Protein Description: zinc finger protein 704
Gene Name: ZNF704
Alternative Gene Name: FLJ16218, Gig1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040209: 92%, ENSRNOG00000054426: 93%
Entrez Gene ID: 619279
Uniprot ID: Q6ZNC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIPGSAKFTPNGSSFSISWQSPPVTFTGIPVSPTHHPVGTGEQRQHAHTVLSSPPRGTVSLRKPRGEGKKCRKVYGMENRDMWCT
• Gene Sequence: TIPGSAKFTPNGSSFSISWQSPPVTFTGIPVSPTHHPVGTGEQRQHAHTVLSSPPRGTVSLRKPRGEGKKCRKVYGMENRDMWCT
• Gene ID - Mouse: ENSMUSG00000040209
• Gene ID - Rat: ENSRNOG00000054426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.