Anti ZNF703 pAb (ATL-HPA023930)

Atlas Antibodies

Catalog No.:
ATL-HPA023930-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 703
Gene Name: ZNF703
Alternative Gene Name: FLJ14299, ZNF503L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085795: 93%, ENSRNOG00000014199: 92%
Entrez Gene ID: 80139
Uniprot ID: Q9H7S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSS
Gene Sequence PYSKGSGGGDSRKDSGSSSVSSTSSSSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSS
Gene ID - Mouse ENSMUSG00000085795
Gene ID - Rat ENSRNOG00000014199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF703 pAb (ATL-HPA023930)
Datasheet Anti ZNF703 pAb (ATL-HPA023930) Datasheet (External Link)
Vendor Page Anti ZNF703 pAb (ATL-HPA023930) at Atlas Antibodies

Documents & Links for Anti ZNF703 pAb (ATL-HPA023930)
Datasheet Anti ZNF703 pAb (ATL-HPA023930) Datasheet (External Link)
Vendor Page Anti ZNF703 pAb (ATL-HPA023930)
Citations for Anti ZNF703 pAb (ATL-HPA023930) – 1 Found
Holland, Daniel G; Burleigh, Angela; Git, Anna; Goldgraben, Mae A; Perez-Mancera, Pedro A; Chin, Suet-Feung; Hurtado, Antonio; Bruna, Alejandra; Ali, H Raza; Greenwood, Wendy; Dunning, Mark J; Samarajiwa, Shamith; Menon, Suraj; Rueda, Oscar M; Lynch, Andy G; McKinney, Steven; Ellis, Ian O; Eaves, Connie J; Carroll, Jason S; Curtis, Christina; Aparicio, Samuel; Caldas, Carlos. ZNF703 is a common Luminal B breast cancer oncogene that differentially regulates luminal and basal progenitors in human mammary epithelium. Embo Molecular Medicine. 2011;3(3):167-80.  PubMed