Anti ZNF7 pAb (ATL-HPA030296)

Atlas Antibodies

Catalog No.: ATL-HPA030296-25

Protein Description: zinc finger protein 7
Gene Name: ZNF7
Alternative Gene Name: HF.16, KOX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033669: 41%, ENSRNOG00000050497: 39%
Entrez Gene ID: 7553
Uniprot ID: P17097
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTKDAP
• Gene Sequence: STIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTKDAP
• Gene ID - Mouse: ENSMUSG00000033669
• Gene ID - Rat: ENSRNOG00000050497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.