Anti ZNF697 pAb (ATL-HPA049933)

Atlas Antibodies

SKU:
ATL-HPA049933-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 697
Gene Name: ZNF697
Alternative Gene Name: MGC45731
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050064: 74%, ENSRNOG00000048181: 74%
Entrez Gene ID: 90874
Uniprot ID: Q5TEC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVSVRGEEDDQSGVADMAMFPGLSESDSISRSLREDDDESAGENRLEEEEEQPAPPVLPWRRHLSLGSRHRGDKPAHRRFHRLHHPMAVDLGELD
Gene Sequence GVSVRGEEDDQSGVADMAMFPGLSESDSISRSLREDDDESAGENRLEEEEEQPAPPVLPWRRHLSLGSRHRGDKPAHRRFHRLHHPMAVDLGELD
Gene ID - Mouse ENSMUSG00000050064
Gene ID - Rat ENSRNOG00000048181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF697 pAb (ATL-HPA049933)
Datasheet Anti ZNF697 pAb (ATL-HPA049933) Datasheet (External Link)
Vendor Page Anti ZNF697 pAb (ATL-HPA049933) at Atlas Antibodies

Documents & Links for Anti ZNF697 pAb (ATL-HPA049933)
Datasheet Anti ZNF697 pAb (ATL-HPA049933) Datasheet (External Link)
Vendor Page Anti ZNF697 pAb (ATL-HPA049933)