Anti ZNF692 pAb (ATL-HPA059337)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059337-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF692
Alternative Gene Name: FLJ20531, Zfp692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037243: 65%, ENSRNOG00000002682: 71%
Entrez Gene ID: 55657
Uniprot ID: Q9BU19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLVWECSAGHTFSWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFP |
| Gene Sequence | GLVWECSAGHTFSWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFP |
| Gene ID - Mouse | ENSMUSG00000037243 |
| Gene ID - Rat | ENSRNOG00000002682 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF692 pAb (ATL-HPA059337) | |
| Datasheet | Anti ZNF692 pAb (ATL-HPA059337) Datasheet (External Link) |
| Vendor Page | Anti ZNF692 pAb (ATL-HPA059337) at Atlas Antibodies |
| Documents & Links for Anti ZNF692 pAb (ATL-HPA059337) | |
| Datasheet | Anti ZNF692 pAb (ATL-HPA059337) Datasheet (External Link) |
| Vendor Page | Anti ZNF692 pAb (ATL-HPA059337) |