Anti ZNF692 pAb (ATL-HPA059337)

Atlas Antibodies

Catalog No.:
ATL-HPA059337-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 692
Gene Name: ZNF692
Alternative Gene Name: FLJ20531, Zfp692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037243: 65%, ENSRNOG00000002682: 71%
Entrez Gene ID: 55657
Uniprot ID: Q9BU19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLVWECSAGHTFSWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFP
Gene Sequence GLVWECSAGHTFSWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFP
Gene ID - Mouse ENSMUSG00000037243
Gene ID - Rat ENSRNOG00000002682
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF692 pAb (ATL-HPA059337)
Datasheet Anti ZNF692 pAb (ATL-HPA059337) Datasheet (External Link)
Vendor Page Anti ZNF692 pAb (ATL-HPA059337) at Atlas Antibodies

Documents & Links for Anti ZNF692 pAb (ATL-HPA059337)
Datasheet Anti ZNF692 pAb (ATL-HPA059337) Datasheet (External Link)
Vendor Page Anti ZNF692 pAb (ATL-HPA059337)