Anti ZNF687 pAb (ATL-HPA023948)

Atlas Antibodies

Catalog No.:
ATL-HPA023948-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 687
Gene Name: ZNF687
Alternative Gene Name: KIAA1441
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019338: 90%, ENSRNOG00000021026: 92%
Entrez Gene ID: 57592
Uniprot ID: Q8N1G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKLSPATPTSEGPKVVSVQLGDGTRLKGTVLPVATIQNASTAMLMAASVARKAVVLPGGTATSPKMIAKNVL
Gene Sequence LKLSPATPTSEGPKVVSVQLGDGTRLKGTVLPVATIQNASTAMLMAASVARKAVVLPGGTATSPKMIAKNVL
Gene ID - Mouse ENSMUSG00000019338
Gene ID - Rat ENSRNOG00000021026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF687 pAb (ATL-HPA023948)
Datasheet Anti ZNF687 pAb (ATL-HPA023948) Datasheet (External Link)
Vendor Page Anti ZNF687 pAb (ATL-HPA023948) at Atlas Antibodies

Documents & Links for Anti ZNF687 pAb (ATL-HPA023948)
Datasheet Anti ZNF687 pAb (ATL-HPA023948) Datasheet (External Link)
Vendor Page Anti ZNF687 pAb (ATL-HPA023948)