Anti ZNF684 pAb (ATL-HPA059153)

Atlas Antibodies

Catalog No.:
ATL-HPA059153-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 684
Gene Name: ZNF684
Alternative Gene Name: MGC27466
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029298: 26%, ENSRNOG00000023007: 26%
Entrez Gene ID: 127396
Uniprot ID: Q5T5D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVEGANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNMSTSLNPMRKKSYKSFEKCLP
Gene Sequence MVEGANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNMSTSLNPMRKKSYKSFEKCLP
Gene ID - Mouse ENSMUSG00000029298
Gene ID - Rat ENSRNOG00000023007
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF684 pAb (ATL-HPA059153)
Datasheet Anti ZNF684 pAb (ATL-HPA059153) Datasheet (External Link)
Vendor Page Anti ZNF684 pAb (ATL-HPA059153) at Atlas Antibodies

Documents & Links for Anti ZNF684 pAb (ATL-HPA059153)
Datasheet Anti ZNF684 pAb (ATL-HPA059153) Datasheet (External Link)
Vendor Page Anti ZNF684 pAb (ATL-HPA059153)