Anti ZNF684 pAb (ATL-HPA059153)

Atlas Antibodies

Catalog No.: ATL-HPA059153-25

Protein Description: zinc finger protein 684
Gene Name: ZNF684
Alternative Gene Name: MGC27466
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029298: 26%, ENSRNOG00000023007: 26%
Entrez Gene ID: 127396
Uniprot ID: Q5T5D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVEGANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNMSTSLNPMRKKSYKSFEKCLP
• Gene Sequence: MVEGANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNMSTSLNPMRKKSYKSFEKCLP
• Gene ID - Mouse: ENSMUSG00000029298
• Gene ID - Rat: ENSRNOG00000023007
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.