Anti ZNF683 pAb (ATL-HPA023865)

Atlas Antibodies

Catalog No.:
ATL-HPA023865-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 683
Gene Name: ZNF683
Alternative Gene Name: MGC33414
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049410: 46%, ENSRNOG00000000323: 31%
Entrez Gene ID: 257101
Uniprot ID: Q8IZ20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYEC
Gene Sequence PSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYEC
Gene ID - Mouse ENSMUSG00000049410
Gene ID - Rat ENSRNOG00000000323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF683 pAb (ATL-HPA023865)
Datasheet Anti ZNF683 pAb (ATL-HPA023865) Datasheet (External Link)
Vendor Page Anti ZNF683 pAb (ATL-HPA023865) at Atlas Antibodies

Documents & Links for Anti ZNF683 pAb (ATL-HPA023865)
Datasheet Anti ZNF683 pAb (ATL-HPA023865) Datasheet (External Link)
Vendor Page Anti ZNF683 pAb (ATL-HPA023865)