Anti ZNF683 pAb (ATL-HPA023865)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023865-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ZNF683
Alternative Gene Name: MGC33414
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049410: 46%, ENSRNOG00000000323: 31%
Entrez Gene ID: 257101
Uniprot ID: Q8IZ20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYEC |
| Gene Sequence | PSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYEC |
| Gene ID - Mouse | ENSMUSG00000049410 |
| Gene ID - Rat | ENSRNOG00000000323 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF683 pAb (ATL-HPA023865) | |
| Datasheet | Anti ZNF683 pAb (ATL-HPA023865) Datasheet (External Link) |
| Vendor Page | Anti ZNF683 pAb (ATL-HPA023865) at Atlas Antibodies |
| Documents & Links for Anti ZNF683 pAb (ATL-HPA023865) | |
| Datasheet | Anti ZNF683 pAb (ATL-HPA023865) Datasheet (External Link) |
| Vendor Page | Anti ZNF683 pAb (ATL-HPA023865) |