Anti ZNF678 pAb (ATL-HPA028507)

Atlas Antibodies

Catalog No.:
ATL-HPA028507-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 678
Gene Name: ZNF678
Alternative Gene Name: MGC42493
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096463: 25%, ENSRNOG00000004165: 24%
Entrez Gene ID: 339500
Uniprot ID: Q5SXM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLCIGVCAFEGANTSTSFYKLVYTAILSYSIQDLLPEQDMKDLCQKVTLTRHRSWGLDNLHLVKDWRTVNEGKGQKEY
Gene Sequence SLCIGVCAFEGANTSTSFYKLVYTAILSYSIQDLLPEQDMKDLCQKVTLTRHRSWGLDNLHLVKDWRTVNEGKGQKEY
Gene ID - Mouse ENSMUSG00000096463
Gene ID - Rat ENSRNOG00000004165
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF678 pAb (ATL-HPA028507)
Datasheet Anti ZNF678 pAb (ATL-HPA028507) Datasheet (External Link)
Vendor Page Anti ZNF678 pAb (ATL-HPA028507) at Atlas Antibodies

Documents & Links for Anti ZNF678 pAb (ATL-HPA028507)
Datasheet Anti ZNF678 pAb (ATL-HPA028507) Datasheet (External Link)
Vendor Page Anti ZNF678 pAb (ATL-HPA028507)