Anti ZNF677 pAb (ATL-HPA023106)

Atlas Antibodies

Catalog No.: ATL-HPA023106-25

Protein Description: zinc finger protein 677
Gene Name: ZNF677
Alternative Gene Name: MGC48625
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040648: 26%, ENSRNOG00000042224: 26%
Entrez Gene ID: 342926
Uniprot ID: Q86XU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVK
• Gene Sequence: NYRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVK
• Gene ID - Mouse: ENSMUSG00000040648
• Gene ID - Rat: ENSRNOG00000042224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.