Anti ZNF672 pAb (ATL-HPA062506)

Atlas Antibodies

Catalog No.:
ATL-HPA062506-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 672
Gene Name: ZNF672
Alternative Gene Name: FLJ22301
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049755: 47%, ENSRNOG00000002713: 47%
Entrez Gene ID: 79894
Uniprot ID: Q499Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQHQRAHTRARTAAAVAIQSAVGTALVFEGPAEQEKPGFSVS
Gene Sequence SQHQRAHTRARTAAAVAIQSAVGTALVFEGPAEQEKPGFSVS
Gene ID - Mouse ENSMUSG00000049755
Gene ID - Rat ENSRNOG00000002713
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF672 pAb (ATL-HPA062506)
Datasheet Anti ZNF672 pAb (ATL-HPA062506) Datasheet (External Link)
Vendor Page Anti ZNF672 pAb (ATL-HPA062506) at Atlas Antibodies

Documents & Links for Anti ZNF672 pAb (ATL-HPA062506)
Datasheet Anti ZNF672 pAb (ATL-HPA062506) Datasheet (External Link)
Vendor Page Anti ZNF672 pAb (ATL-HPA062506)