Anti ZNF672 pAb (ATL-HPA062506)

Atlas Antibodies

Catalog No.: ATL-HPA062506-25

Protein Description: zinc finger protein 672
Gene Name: ZNF672
Alternative Gene Name: FLJ22301
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049755: 47%, ENSRNOG00000002713: 47%
Entrez Gene ID: 79894
Uniprot ID: Q499Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQHQRAHTRARTAAAVAIQSAVGTALVFEGPAEQEKPGFSVS
• Gene Sequence: SQHQRAHTRARTAAAVAIQSAVGTALVFEGPAEQEKPGFSVS
• Gene ID - Mouse: ENSMUSG00000049755
• Gene ID - Rat: ENSRNOG00000002713
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.