Anti ZNF670 pAb (ATL-HPA003142)

Atlas Antibodies

Catalog No.: ATL-HPA003142-25

Protein Description: zinc finger protein 670
Gene Name: ZNF670
Alternative Gene Name: MGC12466
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091764: 53%, ENSRNOG00000011492: 52%
Entrez Gene ID: 93474
Uniprot ID: Q9BS34
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVAVAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPC
• Gene Sequence: DVAVAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPC
• Gene ID - Mouse: ENSMUSG00000091764
• Gene ID - Rat: ENSRNOG00000011492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.