Anti ZNF667 pAb (ATL-HPA030731)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030731-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: ZNF667
Alternative Gene Name: FLJ14011
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054893: 66%, ENSRNOG00000033906: 70%
Entrez Gene ID: 63934
Uniprot ID: Q5HYK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGK |
| Gene Sequence | APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGK |
| Gene ID - Mouse | ENSMUSG00000054893 |
| Gene ID - Rat | ENSRNOG00000033906 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF667 pAb (ATL-HPA030731) | |
| Datasheet | Anti ZNF667 pAb (ATL-HPA030731) Datasheet (External Link) |
| Vendor Page | Anti ZNF667 pAb (ATL-HPA030731) at Atlas Antibodies |
| Documents & Links for Anti ZNF667 pAb (ATL-HPA030731) | |
| Datasheet | Anti ZNF667 pAb (ATL-HPA030731) Datasheet (External Link) |
| Vendor Page | Anti ZNF667 pAb (ATL-HPA030731) |