Anti ZNF658 pAb (ATL-HPA048668)

Atlas Antibodies

Catalog No.:
ATL-HPA048668-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 658
Gene Name: ZNF658
Alternative Gene Name: DKFZp572C163, FLJ32813, MGC35232
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029587: 39%, ENSRNOG00000006958: 39%
Entrez Gene ID: 26149
Uniprot ID: Q5TYW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGINFSRKS
Gene Sequence GKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGINFSRKS
Gene ID - Mouse ENSMUSG00000029587
Gene ID - Rat ENSRNOG00000006958
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF658 pAb (ATL-HPA048668)
Datasheet Anti ZNF658 pAb (ATL-HPA048668) Datasheet (External Link)
Vendor Page Anti ZNF658 pAb (ATL-HPA048668) at Atlas Antibodies

Documents & Links for Anti ZNF658 pAb (ATL-HPA048668)
Datasheet Anti ZNF658 pAb (ATL-HPA048668) Datasheet (External Link)
Vendor Page Anti ZNF658 pAb (ATL-HPA048668)