Anti ZNF655 pAb (ATL-HPA050750)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050750-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF655
Alternative Gene Name: VIK, VIK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007812: 55%, ENSRNOG00000060129: 56%
Entrez Gene ID: 79027
Uniprot ID: Q8N720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYKVRV |
| Gene Sequence | MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYKVRV |
| Gene ID - Mouse | ENSMUSG00000007812 |
| Gene ID - Rat | ENSRNOG00000060129 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF655 pAb (ATL-HPA050750) | |
| Datasheet | Anti ZNF655 pAb (ATL-HPA050750) Datasheet (External Link) |
| Vendor Page | Anti ZNF655 pAb (ATL-HPA050750) at Atlas Antibodies |
| Documents & Links for Anti ZNF655 pAb (ATL-HPA050750) | |
| Datasheet | Anti ZNF655 pAb (ATL-HPA050750) Datasheet (External Link) |
| Vendor Page | Anti ZNF655 pAb (ATL-HPA050750) |