Anti ZNF653 pAb (ATL-HPA023635)

Atlas Antibodies

Catalog No.: ATL-HPA023635-100

Protein Description: zinc finger protein 653
Gene Name: ZNF653
Alternative Gene Name: Zip67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038895: 98%, ENSRNOG00000014065: 96%
Entrez Gene ID: 115950
Uniprot ID: Q96CK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVGNGLVAGSSDSSSSGS
• Gene Sequence: NVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVGNGLVAGSSDSSSSGS
• Gene ID - Mouse: ENSMUSG00000038895
• Gene ID - Rat: ENSRNOG00000014065
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.