Anti ZNF639 pAb (ATL-HPA049023)

Atlas Antibodies

Catalog No.:
ATL-HPA049023-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 639
Gene Name: ZNF639
Alternative Gene Name: ANC-2H01, ZASC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027667: 87%, ENSRNOG00000043053: 86%
Entrez Gene ID: 51193
Uniprot ID: Q9UID6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQ
Gene Sequence SADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQ
Gene ID - Mouse ENSMUSG00000027667
Gene ID - Rat ENSRNOG00000043053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF639 pAb (ATL-HPA049023)
Datasheet Anti ZNF639 pAb (ATL-HPA049023) Datasheet (External Link)
Vendor Page Anti ZNF639 pAb (ATL-HPA049023) at Atlas Antibodies

Documents & Links for Anti ZNF639 pAb (ATL-HPA049023)
Datasheet Anti ZNF639 pAb (ATL-HPA049023) Datasheet (External Link)
Vendor Page Anti ZNF639 pAb (ATL-HPA049023)