Anti ZNF639 pAb (ATL-HPA049023)

Atlas Antibodies

Catalog No.: ATL-HPA049023-25

Protein Description: zinc finger protein 639
Gene Name: ZNF639
Alternative Gene Name: ANC-2H01, ZASC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027667: 87%, ENSRNOG00000043053: 86%
Entrez Gene ID: 51193
Uniprot ID: Q9UID6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQ
• Gene Sequence: SADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQ
• Gene ID - Mouse: ENSMUSG00000027667
• Gene ID - Rat: ENSRNOG00000043053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.