Anti ZNF629 pAb (ATL-HPA019550)

Atlas Antibodies

Catalog No.:
ATL-HPA019550-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 629
Gene Name: ZNF629
Alternative Gene Name: KIAA0326, ZNF65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045639: 67%, ENSRNOG00000018877: 70%
Entrez Gene ID: 23361
Uniprot ID: Q9UEG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NADGLIAHAAPKPPQLRSPRLPFRGNSYPGAAEGRAEAPGQPLKPPEGQEGFSQRRGLLSSKT
Gene Sequence NADGLIAHAAPKPPQLRSPRLPFRGNSYPGAAEGRAEAPGQPLKPPEGQEGFSQRRGLLSSKT
Gene ID - Mouse ENSMUSG00000045639
Gene ID - Rat ENSRNOG00000018877
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF629 pAb (ATL-HPA019550)
Datasheet Anti ZNF629 pAb (ATL-HPA019550) Datasheet (External Link)
Vendor Page Anti ZNF629 pAb (ATL-HPA019550) at Atlas Antibodies

Documents & Links for Anti ZNF629 pAb (ATL-HPA019550)
Datasheet Anti ZNF629 pAb (ATL-HPA019550) Datasheet (External Link)
Vendor Page Anti ZNF629 pAb (ATL-HPA019550)