Anti ZNF627 pAb (ATL-HPA049770)

Atlas Antibodies

Catalog No.: ATL-HPA049770-25

Protein Description: zinc finger protein 627
Gene Name: ZNF627
Alternative Gene Name: FLJ90365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109771: 44%, ENSRNOG00000000891: 45%
Entrez Gene ID: 199692
Uniprot ID: Q7L945
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHIRDHTGREPNEYQEYGKKSYTRNQCGRALSYHRSFPVRERTHPGGKP
• Gene Sequence: RHIRDHTGREPNEYQEYGKKSYTRNQCGRALSYHRSFPVRERTHPGGKP
• Gene ID - Mouse: ENSMUSG00000109771
• Gene ID - Rat: ENSRNOG00000000891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.