Anti ZNF621 pAb (ATL-HPA071440)

Atlas Antibodies

Catalog No.:
ATL-HPA071440-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 621
Gene Name: ZNF621
Alternative Gene Name: FLJ45246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037989: 27%, ENSRNOG00000019318: 27%
Entrez Gene ID: 285268
Uniprot ID: Q6ZSS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLT
Gene Sequence WYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVAVPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLT
Gene ID - Mouse ENSMUSG00000037989
Gene ID - Rat ENSRNOG00000019318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF621 pAb (ATL-HPA071440)
Datasheet Anti ZNF621 pAb (ATL-HPA071440) Datasheet (External Link)
Vendor Page Anti ZNF621 pAb (ATL-HPA071440) at Atlas Antibodies

Documents & Links for Anti ZNF621 pAb (ATL-HPA071440)
Datasheet Anti ZNF621 pAb (ATL-HPA071440) Datasheet (External Link)
Vendor Page Anti ZNF621 pAb (ATL-HPA071440)