Anti ZNF621 pAb (ATL-HPA065518)

Atlas Antibodies

Catalog No.:
ATL-HPA065518-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 621
Gene Name: ZNF621
Alternative Gene Name: FLJ45246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029761: 26%, ENSRNOG00000010233: 26%
Entrez Gene ID: 285268
Uniprot ID: Q6ZSS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNL
Gene Sequence RGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNL
Gene ID - Mouse ENSMUSG00000029761
Gene ID - Rat ENSRNOG00000010233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF621 pAb (ATL-HPA065518)
Datasheet Anti ZNF621 pAb (ATL-HPA065518) Datasheet (External Link)
Vendor Page Anti ZNF621 pAb (ATL-HPA065518) at Atlas Antibodies

Documents & Links for Anti ZNF621 pAb (ATL-HPA065518)
Datasheet Anti ZNF621 pAb (ATL-HPA065518) Datasheet (External Link)
Vendor Page Anti ZNF621 pAb (ATL-HPA065518)