Anti ZNF620 pAb (ATL-HPA059383)

Atlas Antibodies

Catalog No.:
ATL-HPA059383-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 620
Gene Name: ZNF620
Alternative Gene Name: MGC50836
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021109: 30%, ENSRNOG00000053889: 33%
Entrez Gene ID: 253639
Uniprot ID: Q6ZNG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKEGLTPKDHVSKETESFRLMVGGLPGNVSQHLDFGSSLEQPQGHWIIKTK
Gene Sequence EKEGLTPKDHVSKETESFRLMVGGLPGNVSQHLDFGSSLEQPQGHWIIKTK
Gene ID - Mouse ENSMUSG00000021109
Gene ID - Rat ENSRNOG00000053889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF620 pAb (ATL-HPA059383)
Datasheet Anti ZNF620 pAb (ATL-HPA059383) Datasheet (External Link)
Vendor Page Anti ZNF620 pAb (ATL-HPA059383) at Atlas Antibodies

Documents & Links for Anti ZNF620 pAb (ATL-HPA059383)
Datasheet Anti ZNF620 pAb (ATL-HPA059383) Datasheet (External Link)
Vendor Page Anti ZNF620 pAb (ATL-HPA059383)