Anti ZNF616 pAb (ATL-HPA071539)

Atlas Antibodies

Catalog No.:
ATL-HPA071539-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 616
Gene Name: ZNF616
Alternative Gene Name: MGC45556
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096856: 37%, ENSRNOG00000053687: 36%
Entrez Gene ID: 90317
Uniprot ID: Q08AN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCN
Gene Sequence NQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCN
Gene ID - Mouse ENSMUSG00000096856
Gene ID - Rat ENSRNOG00000053687
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF616 pAb (ATL-HPA071539)
Datasheet Anti ZNF616 pAb (ATL-HPA071539) Datasheet (External Link)
Vendor Page Anti ZNF616 pAb (ATL-HPA071539) at Atlas Antibodies

Documents & Links for Anti ZNF616 pAb (ATL-HPA071539)
Datasheet Anti ZNF616 pAb (ATL-HPA071539) Datasheet (External Link)
Vendor Page Anti ZNF616 pAb (ATL-HPA071539)