Anti ZNF614 pAb (ATL-HPA021197)

Atlas Antibodies

Catalog No.: ATL-HPA021197-25

Protein Description: zinc finger protein 614
Gene Name: ZNF614
Alternative Gene Name: FLJ21941
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045328: 26%, ENSRNOG00000061506: 28%
Entrez Gene ID: 80110
Uniprot ID: Q8N883
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVE
• Gene Sequence: GKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVE
• Gene ID - Mouse: ENSMUSG00000045328
• Gene ID - Rat: ENSRNOG00000061506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.