Anti ZNF608 pAb (ATL-HPA076984)

Atlas Antibodies

Catalog No.:
ATL-HPA076984-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 608
Gene Name: ZNF608
Alternative Gene Name: DKFZp434M098, KIAA1281, NY-REN-36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052713: 87%, ENSRNOG00000023197: 83%
Entrez Gene ID: 57507
Uniprot ID: Q9ULD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIISSKDSVVKGHSSTTAQSSQLKESHSPYYHSYDPYYSPSYMHPGQVGAPAAGNSGSTQGMKIKKESEEDAEKKD
Gene Sequence DIISSKDSVVKGHSSTTAQSSQLKESHSPYYHSYDPYYSPSYMHPGQVGAPAAGNSGSTQGMKIKKESEEDAEKKD
Gene ID - Mouse ENSMUSG00000052713
Gene ID - Rat ENSRNOG00000023197
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF608 pAb (ATL-HPA076984)
Datasheet Anti ZNF608 pAb (ATL-HPA076984) Datasheet (External Link)
Vendor Page Anti ZNF608 pAb (ATL-HPA076984) at Atlas Antibodies

Documents & Links for Anti ZNF608 pAb (ATL-HPA076984)
Datasheet Anti ZNF608 pAb (ATL-HPA076984) Datasheet (External Link)
Vendor Page Anti ZNF608 pAb (ATL-HPA076984)