Anti ZNF607 pAb (ATL-HPA055018)

Atlas Antibodies

Catalog No.:
ATL-HPA055018-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 607
Gene Name: ZNF607
Alternative Gene Name: FLJ14802, MGC13071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046311: 33%, ENSRNOG00000020087: 35%
Entrez Gene ID: 84775
Uniprot ID: Q96SK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVREETRGECTDLDSRCEIISDGKMQLYRKHSCVTLHQRIHNG
Gene Sequence IVREETRGECTDLDSRCEIISDGKMQLYRKHSCVTLHQRIHNG
Gene ID - Mouse ENSMUSG00000046311
Gene ID - Rat ENSRNOG00000020087
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF607 pAb (ATL-HPA055018)
Datasheet Anti ZNF607 pAb (ATL-HPA055018) Datasheet (External Link)
Vendor Page Anti ZNF607 pAb (ATL-HPA055018) at Atlas Antibodies

Documents & Links for Anti ZNF607 pAb (ATL-HPA055018)
Datasheet Anti ZNF607 pAb (ATL-HPA055018) Datasheet (External Link)
Vendor Page Anti ZNF607 pAb (ATL-HPA055018)