Anti ZNF607 pAb (ATL-HPA049465)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049465-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF607
Alternative Gene Name: FLJ14802, MGC13071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063281: 54%, ENSRNOG00000015271: 56%
Entrez Gene ID: 84775
Uniprot ID: Q96SK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QCQKSFSHLTELMVHQTIHTSEEPDQCEKFRKAFSHLTDLRKHQKINAREKPYE |
Gene Sequence | QCQKSFSHLTELMVHQTIHTSEEPDQCEKFRKAFSHLTDLRKHQKINAREKPYE |
Gene ID - Mouse | ENSMUSG00000063281 |
Gene ID - Rat | ENSRNOG00000015271 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF607 pAb (ATL-HPA049465) | |
Datasheet | Anti ZNF607 pAb (ATL-HPA049465) Datasheet (External Link) |
Vendor Page | Anti ZNF607 pAb (ATL-HPA049465) at Atlas Antibodies |
Documents & Links for Anti ZNF607 pAb (ATL-HPA049465) | |
Datasheet | Anti ZNF607 pAb (ATL-HPA049465) Datasheet (External Link) |
Vendor Page | Anti ZNF607 pAb (ATL-HPA049465) |