Anti ZNF607 pAb (ATL-HPA049465)

Atlas Antibodies

Catalog No.:
ATL-HPA049465-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 607
Gene Name: ZNF607
Alternative Gene Name: FLJ14802, MGC13071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063281: 54%, ENSRNOG00000015271: 56%
Entrez Gene ID: 84775
Uniprot ID: Q96SK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCQKSFSHLTELMVHQTIHTSEEPDQCEKFRKAFSHLTDLRKHQKINAREKPYE
Gene Sequence QCQKSFSHLTELMVHQTIHTSEEPDQCEKFRKAFSHLTDLRKHQKINAREKPYE
Gene ID - Mouse ENSMUSG00000063281
Gene ID - Rat ENSRNOG00000015271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF607 pAb (ATL-HPA049465)
Datasheet Anti ZNF607 pAb (ATL-HPA049465) Datasheet (External Link)
Vendor Page Anti ZNF607 pAb (ATL-HPA049465) at Atlas Antibodies

Documents & Links for Anti ZNF607 pAb (ATL-HPA049465)
Datasheet Anti ZNF607 pAb (ATL-HPA049465) Datasheet (External Link)
Vendor Page Anti ZNF607 pAb (ATL-HPA049465)