Anti ZNF605 pAb (ATL-HPA062655)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062655-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF605
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023284: 44%, ENSRNOG00000037428: 44%
Entrez Gene ID: 100289635
Uniprot ID: Q86T29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF |
| Gene Sequence | CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF |
| Gene ID - Mouse | ENSMUSG00000023284 |
| Gene ID - Rat | ENSRNOG00000037428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF605 pAb (ATL-HPA062655) | |
| Datasheet | Anti ZNF605 pAb (ATL-HPA062655) Datasheet (External Link) |
| Vendor Page | Anti ZNF605 pAb (ATL-HPA062655) at Atlas Antibodies |
| Documents & Links for Anti ZNF605 pAb (ATL-HPA062655) | |
| Datasheet | Anti ZNF605 pAb (ATL-HPA062655) Datasheet (External Link) |
| Vendor Page | Anti ZNF605 pAb (ATL-HPA062655) |