Anti ZNF605 pAb (ATL-HPA062655)

Atlas Antibodies

Catalog No.:
ATL-HPA062655-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 605
Gene Name: ZNF605
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023284: 44%, ENSRNOG00000037428: 44%
Entrez Gene ID: 100289635
Uniprot ID: Q86T29
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF
Gene Sequence CIKPGRTHGGIKYCDCSTCRKSSNEEPWLTANHITHTGVYLCMECGRF
Gene ID - Mouse ENSMUSG00000023284
Gene ID - Rat ENSRNOG00000037428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF605 pAb (ATL-HPA062655)
Datasheet Anti ZNF605 pAb (ATL-HPA062655) Datasheet (External Link)
Vendor Page Anti ZNF605 pAb (ATL-HPA062655) at Atlas Antibodies

Documents & Links for Anti ZNF605 pAb (ATL-HPA062655)
Datasheet Anti ZNF605 pAb (ATL-HPA062655) Datasheet (External Link)
Vendor Page Anti ZNF605 pAb (ATL-HPA062655)