Anti ZNF594 pAb (ATL-HPA069360)

Atlas Antibodies

Catalog No.:
ATL-HPA069360-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 594
Gene Name: ZNF594
Alternative Gene Name: KIAA1871
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005267: 48%, ENSRNOG00000049975: 50%
Entrez Gene ID: 84622
Uniprot ID: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHAGEKLEECEKTFSKDEELRKEQRTHQEKKVYWCNQCSRTFQGSSDLIRH
Gene Sequence LHAGEKLEECEKTFSKDEELRKEQRTHQEKKVYWCNQCSRTFQGSSDLIRH
Gene ID - Mouse ENSMUSG00000005267
Gene ID - Rat ENSRNOG00000049975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF594 pAb (ATL-HPA069360)
Datasheet Anti ZNF594 pAb (ATL-HPA069360) Datasheet (External Link)
Vendor Page Anti ZNF594 pAb (ATL-HPA069360) at Atlas Antibodies

Documents & Links for Anti ZNF594 pAb (ATL-HPA069360)
Datasheet Anti ZNF594 pAb (ATL-HPA069360) Datasheet (External Link)
Vendor Page Anti ZNF594 pAb (ATL-HPA069360)