Anti ZNF594 pAb (ATL-HPA067178)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067178-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF594
Alternative Gene Name: KIAA1871
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037007: 52%, ENSRNOG00000049975: 52%
Entrez Gene ID: 84622
Uniprot ID: Q96JF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV |
| Gene Sequence | QRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQV |
| Gene ID - Mouse | ENSMUSG00000037007 |
| Gene ID - Rat | ENSRNOG00000049975 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF594 pAb (ATL-HPA067178) | |
| Datasheet | Anti ZNF594 pAb (ATL-HPA067178) Datasheet (External Link) |
| Vendor Page | Anti ZNF594 pAb (ATL-HPA067178) at Atlas Antibodies |
| Documents & Links for Anti ZNF594 pAb (ATL-HPA067178) | |
| Datasheet | Anti ZNF594 pAb (ATL-HPA067178) Datasheet (External Link) |
| Vendor Page | Anti ZNF594 pAb (ATL-HPA067178) |