Anti ZNF593 pAb (ATL-HPA054363)

Atlas Antibodies

Catalog No.:
ATL-HPA054363-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 593
Gene Name: ZNF593
Alternative Gene Name: ZT86
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028840: 90%, ENSRNOG00000016392: 92%
Entrez Gene ID: 51042
Uniprot ID: O00488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST
Gene Sequence DSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST
Gene ID - Mouse ENSMUSG00000028840
Gene ID - Rat ENSRNOG00000016392
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF593 pAb (ATL-HPA054363)
Datasheet Anti ZNF593 pAb (ATL-HPA054363) Datasheet (External Link)
Vendor Page Anti ZNF593 pAb (ATL-HPA054363) at Atlas Antibodies

Documents & Links for Anti ZNF593 pAb (ATL-HPA054363)
Datasheet Anti ZNF593 pAb (ATL-HPA054363) Datasheet (External Link)
Vendor Page Anti ZNF593 pAb (ATL-HPA054363)