Anti ZNF579 pAb (ATL-HPA062812)

Atlas Antibodies

Catalog No.:
ATL-HPA062812-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 579
Gene Name: ZNF579
Alternative Gene Name: FLJ35453
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051550: 100%, ENSRNOG00000016608: 100%
Entrez Gene ID: 163033
Uniprot ID: Q8NAF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAELRAELALAAGRQEEKQVLLQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQC
Gene Sequence AAELRAELALAAGRQEEKQVLLQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQC
Gene ID - Mouse ENSMUSG00000051550
Gene ID - Rat ENSRNOG00000016608
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF579 pAb (ATL-HPA062812)
Datasheet Anti ZNF579 pAb (ATL-HPA062812) Datasheet (External Link)
Vendor Page Anti ZNF579 pAb (ATL-HPA062812) at Atlas Antibodies

Documents & Links for Anti ZNF579 pAb (ATL-HPA062812)
Datasheet Anti ZNF579 pAb (ATL-HPA062812) Datasheet (External Link)
Vendor Page Anti ZNF579 pAb (ATL-HPA062812)