Anti ZNF576 pAb (ATL-HPA050064)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050064-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF576
Alternative Gene Name: MGC2508
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029345: 31%, ENSRNOG00000000663: 31%
Entrez Gene ID: 79177
Uniprot ID: Q9H609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFV |
Gene Sequence | MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFV |
Gene ID - Mouse | ENSMUSG00000029345 |
Gene ID - Rat | ENSRNOG00000000663 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF576 pAb (ATL-HPA050064) | |
Datasheet | Anti ZNF576 pAb (ATL-HPA050064) Datasheet (External Link) |
Vendor Page | Anti ZNF576 pAb (ATL-HPA050064) at Atlas Antibodies |
Documents & Links for Anti ZNF576 pAb (ATL-HPA050064) | |
Datasheet | Anti ZNF576 pAb (ATL-HPA050064) Datasheet (External Link) |
Vendor Page | Anti ZNF576 pAb (ATL-HPA050064) |