Anti ZNF576 pAb (ATL-HPA050064)

Atlas Antibodies

Catalog No.:
ATL-HPA050064-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 576
Gene Name: ZNF576
Alternative Gene Name: MGC2508
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029345: 31%, ENSRNOG00000000663: 31%
Entrez Gene ID: 79177
Uniprot ID: Q9H609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFV
Gene Sequence MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPADFV
Gene ID - Mouse ENSMUSG00000029345
Gene ID - Rat ENSRNOG00000000663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF576 pAb (ATL-HPA050064)
Datasheet Anti ZNF576 pAb (ATL-HPA050064) Datasheet (External Link)
Vendor Page Anti ZNF576 pAb (ATL-HPA050064) at Atlas Antibodies

Documents & Links for Anti ZNF576 pAb (ATL-HPA050064)
Datasheet Anti ZNF576 pAb (ATL-HPA050064) Datasheet (External Link)
Vendor Page Anti ZNF576 pAb (ATL-HPA050064)