Anti ZNF575 pAb (ATL-HPA051865)

Atlas Antibodies

Catalog No.:
ATL-HPA051865-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 575
Gene Name: ZNF575
Alternative Gene Name: FLJ32567
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049807: 36%, ENSRNOG00000008061: 40%
Entrez Gene ID: 284346
Uniprot ID: Q86XF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGSCASKMLERGAESAAGATDPSPTGKEPVTKEAPHQGPPQKPS
Gene Sequence LGSCASKMLERGAESAAGATDPSPTGKEPVTKEAPHQGPPQKPS
Gene ID - Mouse ENSMUSG00000049807
Gene ID - Rat ENSRNOG00000008061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF575 pAb (ATL-HPA051865)
Datasheet Anti ZNF575 pAb (ATL-HPA051865) Datasheet (External Link)
Vendor Page Anti ZNF575 pAb (ATL-HPA051865) at Atlas Antibodies

Documents & Links for Anti ZNF575 pAb (ATL-HPA051865)
Datasheet Anti ZNF575 pAb (ATL-HPA051865) Datasheet (External Link)
Vendor Page Anti ZNF575 pAb (ATL-HPA051865)