Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA066838-25
  • Immunohistochemistry analysis in human testis and duodenum tissues using Anti-ZNF572 antibody. Corresponding ZNF572 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 572
Gene Name: ZNF572
Alternative Gene Name: FLJ38002
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021388: 27%, ENSRNOG00000013451: 29%
Entrez Gene ID: 137209
Uniprot ID: Q7Z3I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSNSFMERESLKSPFTGDTSMNNLETVHHNNSKADKLKEKPSEWSKRHRPQHYKHEDAKEMPL
Gene Sequence DSNSFMERESLKSPFTGDTSMNNLETVHHNNSKADKLKEKPSEWSKRHRPQHYKHEDAKEMPL
Gene ID - Mouse ENSMUSG00000021388
Gene ID - Rat ENSRNOG00000013451
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation)
Datasheet Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF572 pAb (ATL-HPA066838 w/enhanced validation)