Anti ZNF568 pAb (ATL-HPA052061)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052061-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZNF568
Alternative Gene Name: DKFZp686B0797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078435: 36%, ENSRNOG00000056374: 36%
Entrez Gene ID: 374900
Uniprot ID: Q3ZCX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRHER |
| Gene Sequence | KGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRHER |
| Gene ID - Mouse | ENSMUSG00000078435 |
| Gene ID - Rat | ENSRNOG00000056374 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF568 pAb (ATL-HPA052061) | |
| Datasheet | Anti ZNF568 pAb (ATL-HPA052061) Datasheet (External Link) |
| Vendor Page | Anti ZNF568 pAb (ATL-HPA052061) at Atlas Antibodies |
| Documents & Links for Anti ZNF568 pAb (ATL-HPA052061) | |
| Datasheet | Anti ZNF568 pAb (ATL-HPA052061) Datasheet (External Link) |
| Vendor Page | Anti ZNF568 pAb (ATL-HPA052061) |