Anti ZNF568 pAb (ATL-HPA052061)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052061-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF568
Alternative Gene Name: DKFZp686B0797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078435: 36%, ENSRNOG00000056374: 36%
Entrez Gene ID: 374900
Uniprot ID: Q3ZCX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRHER |
Gene Sequence | KGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRHER |
Gene ID - Mouse | ENSMUSG00000078435 |
Gene ID - Rat | ENSRNOG00000056374 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF568 pAb (ATL-HPA052061) | |
Datasheet | Anti ZNF568 pAb (ATL-HPA052061) Datasheet (External Link) |
Vendor Page | Anti ZNF568 pAb (ATL-HPA052061) at Atlas Antibodies |
Documents & Links for Anti ZNF568 pAb (ATL-HPA052061) | |
Datasheet | Anti ZNF568 pAb (ATL-HPA052061) Datasheet (External Link) |
Vendor Page | Anti ZNF568 pAb (ATL-HPA052061) |