Anti ZNF555 pAb (ATL-HPA053956)

Atlas Antibodies

Catalog No.: ATL-HPA053956-100

Protein Description: zinc finger protein 555
Gene Name: ZNF555
Alternative Gene Name: MGC26707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074735: 48%, ENSRNOG00000048894: 46%
Entrez Gene ID: 148254
Uniprot ID: Q8NEP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY
• Gene Sequence: GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY
• Gene ID - Mouse: ENSMUSG00000074735
• Gene ID - Rat: ENSRNOG00000048894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.