Anti ZNF555 pAb (ATL-HPA053956)

Atlas Antibodies

Catalog No.:
ATL-HPA053956-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 555
Gene Name: ZNF555
Alternative Gene Name: MGC26707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074735: 48%, ENSRNOG00000048894: 46%
Entrez Gene ID: 148254
Uniprot ID: Q8NEP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY
Gene Sequence GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY
Gene ID - Mouse ENSMUSG00000074735
Gene ID - Rat ENSRNOG00000048894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF555 pAb (ATL-HPA053956)
Datasheet Anti ZNF555 pAb (ATL-HPA053956) Datasheet (External Link)
Vendor Page Anti ZNF555 pAb (ATL-HPA053956) at Atlas Antibodies

Documents & Links for Anti ZNF555 pAb (ATL-HPA053956)
Datasheet Anti ZNF555 pAb (ATL-HPA053956) Datasheet (External Link)
Vendor Page Anti ZNF555 pAb (ATL-HPA053956)