Anti ZNF555 pAb (ATL-HPA053956)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053956-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ZNF555
Alternative Gene Name: MGC26707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074735: 48%, ENSRNOG00000048894: 46%
Entrez Gene ID: 148254
Uniprot ID: Q8NEP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY |
Gene Sequence | GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY |
Gene ID - Mouse | ENSMUSG00000074735 |
Gene ID - Rat | ENSRNOG00000048894 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF555 pAb (ATL-HPA053956) | |
Datasheet | Anti ZNF555 pAb (ATL-HPA053956) Datasheet (External Link) |
Vendor Page | Anti ZNF555 pAb (ATL-HPA053956) at Atlas Antibodies |
Documents & Links for Anti ZNF555 pAb (ATL-HPA053956) | |
Datasheet | Anti ZNF555 pAb (ATL-HPA053956) Datasheet (External Link) |
Vendor Page | Anti ZNF555 pAb (ATL-HPA053956) |