Anti ZNF555 pAb (ATL-HPA053956)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053956-100
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/96268/174537/atl-hpa053956_anti-znf555-pab-atl-hpa053956_56192__07137.1681129034.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue")
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ZNF555
Alternative Gene Name: MGC26707
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074735: 48%, ENSRNOG00000048894: 46%
Entrez Gene ID: 148254
Uniprot ID: Q8NEP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY |
| Gene Sequence | GEALSQIPHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPY |
| Gene ID - Mouse | ENSMUSG00000074735 |
| Gene ID - Rat | ENSRNOG00000048894 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF555 pAb (ATL-HPA053956) | |
| Datasheet | Anti ZNF555 pAb (ATL-HPA053956) Datasheet (External Link) |
| Vendor Page | Anti ZNF555 pAb (ATL-HPA053956) at Atlas Antibodies |
| Documents & Links for Anti ZNF555 pAb (ATL-HPA053956) | |
| Datasheet | Anti ZNF555 pAb (ATL-HPA053956) Datasheet (External Link) |
| Vendor Page | Anti ZNF555 pAb (ATL-HPA053956) |