Anti ZNF554 pAb (ATL-HPA060247)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060247-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF554
Alternative Gene Name: FLJ34817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057551: 25%, ENSRNOG00000056826: 28%
Entrez Gene ID: 115196
Uniprot ID: Q86TJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQ |
| Gene Sequence | KNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQ |
| Gene ID - Mouse | ENSMUSG00000057551 |
| Gene ID - Rat | ENSRNOG00000056826 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF554 pAb (ATL-HPA060247) | |
| Datasheet | Anti ZNF554 pAb (ATL-HPA060247) Datasheet (External Link) |
| Vendor Page | Anti ZNF554 pAb (ATL-HPA060247) at Atlas Antibodies |
| Documents & Links for Anti ZNF554 pAb (ATL-HPA060247) | |
| Datasheet | Anti ZNF554 pAb (ATL-HPA060247) Datasheet (External Link) |
| Vendor Page | Anti ZNF554 pAb (ATL-HPA060247) |