Anti ZNF554 pAb (ATL-HPA060247)

Atlas Antibodies

Catalog No.:
ATL-HPA060247-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 554
Gene Name: ZNF554
Alternative Gene Name: FLJ34817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057551: 25%, ENSRNOG00000056826: 28%
Entrez Gene ID: 115196
Uniprot ID: Q86TJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQ
Gene Sequence KNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQ
Gene ID - Mouse ENSMUSG00000057551
Gene ID - Rat ENSRNOG00000056826
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF554 pAb (ATL-HPA060247)
Datasheet Anti ZNF554 pAb (ATL-HPA060247) Datasheet (External Link)
Vendor Page Anti ZNF554 pAb (ATL-HPA060247) at Atlas Antibodies

Documents & Links for Anti ZNF554 pAb (ATL-HPA060247)
Datasheet Anti ZNF554 pAb (ATL-HPA060247) Datasheet (External Link)
Vendor Page Anti ZNF554 pAb (ATL-HPA060247)