Anti ZNF554 pAb (ATL-HPA060247)

Atlas Antibodies

Catalog No.: ATL-HPA060247-25

Protein Description: zinc finger protein 554
Gene Name: ZNF554
Alternative Gene Name: FLJ34817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057551: 25%, ENSRNOG00000056826: 28%
Entrez Gene ID: 115196
Uniprot ID: Q86TJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQ
• Gene Sequence: KNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQ
• Gene ID - Mouse: ENSMUSG00000057551
• Gene ID - Rat: ENSRNOG00000056826
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.