Anti ZNF532 pAb (ATL-HPA015322)

Atlas Antibodies

Catalog No.: ATL-HPA015322-25

Protein Description: zinc finger protein 532
Gene Name: ZNF532
Alternative Gene Name: FLJ10697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042439: 87%, ENSRNOG00000017116: 93%
Entrez Gene ID: 55205
Uniprot ID: Q9HCE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRTFTKRLMLEKHVQLMHGIKDPDLKEMTDATNEEETEIKEDTKVPSPKRKLEEPVLEFRPPRGAITQPLKKLKINVFKVHKCAVCGFTTENLLQFHEHIPQHKSDGSS
• Gene Sequence: RRTFTKRLMLEKHVQLMHGIKDPDLKEMTDATNEEETEIKEDTKVPSPKRKLEEPVLEFRPPRGAITQPLKKLKINVFKVHKCAVCGFTTENLLQFHEHIPQHKSDGSS
• Gene ID - Mouse: ENSMUSG00000042439
• Gene ID - Rat: ENSRNOG00000017116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF532 pAb (ATL-HPA015322) – 1 Found

Fan, Liang; Wang, Jinxiu; Deng, Pingping; Wang, Yuanyuan; Zhang, Aiping; Yang, Mengsheng; Zeng, Gang. Foxhead box D1 promotes the partial epithelial-to-mesenchymal transition of laryngeal squamous cell carcinoma cells via transcriptionally activating the expression of zinc finger protein 532. Bioengineered. 2022;13(2):3057-3069.