Anti ZNF526 pAb (ATL-HPA056609)

Atlas Antibodies

Catalog No.: ATL-HPA056609-25

Protein Description: zinc finger protein 526
Gene Name: ZNF526
Alternative Gene Name: KIAA1951, MGC4267
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046541: 79%, ENSRNOG00000047526: 79%
Entrez Gene ID: 116115
Uniprot ID: Q8TF50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAV
• Gene Sequence: AEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAV
• Gene ID - Mouse: ENSMUSG00000046541
• Gene ID - Rat: ENSRNOG00000047526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.