Anti ZNF526 pAb (ATL-HPA056609)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056609-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZNF526
Alternative Gene Name: KIAA1951, MGC4267
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046541: 79%, ENSRNOG00000047526: 79%
Entrez Gene ID: 116115
Uniprot ID: Q8TF50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAV |
| Gene Sequence | AEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAV |
| Gene ID - Mouse | ENSMUSG00000046541 |
| Gene ID - Rat | ENSRNOG00000047526 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF526 pAb (ATL-HPA056609) | |
| Datasheet | Anti ZNF526 pAb (ATL-HPA056609) Datasheet (External Link) |
| Vendor Page | Anti ZNF526 pAb (ATL-HPA056609) at Atlas Antibodies |
| Documents & Links for Anti ZNF526 pAb (ATL-HPA056609) | |
| Datasheet | Anti ZNF526 pAb (ATL-HPA056609) Datasheet (External Link) |
| Vendor Page | Anti ZNF526 pAb (ATL-HPA056609) |