Anti ZNF519 pAb (ATL-HPA028982)

Atlas Antibodies

Catalog No.: ATL-HPA028982-25

Protein Description: zinc finger protein 519
Gene Name: ZNF519
Alternative Gene Name: FLJ36809, HsT2362
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042063: 40%, ENSRNOG00000004268: 44%
Entrez Gene ID: 162655
Uniprot ID: Q8TB69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIQDSFKKATLGRYGSCGLENICLWKNWESIGEGEGQKECYNLCSQYLTTSHNKHLTVKGDKEY
• Gene Sequence: EEWKCLDPAQQNLYRDVMLENYRNLVSLAVYSYYNQGILPEQGIQDSFKKATLGRYGSCGLENICLWKNWESIGEGEGQKECYNLCSQYLTTSHNKHLTVKGDKEY
• Gene ID - Mouse: ENSMUSG00000042063
• Gene ID - Rat: ENSRNOG00000004268
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.