Anti ZNF510 pAb (ATL-HPA049139)

Atlas Antibodies

Catalog No.: ATL-HPA049139-25

Protein Description: zinc finger protein 510
Gene Name: ZNF510
Alternative Gene Name: KIAA0972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094786: 34%, ENSRNOG00000029336: 33%
Entrez Gene ID: 22869
Uniprot ID: Q9Y2H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIEENPLVSNDRTQTWVKSSEYHENKKS
• Gene Sequence: FDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIEENPLVSNDRTQTWVKSSEYHENKKS
• Gene ID - Mouse: ENSMUSG00000094786
• Gene ID - Rat: ENSRNOG00000029336
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.