Anti ZNF510 pAb (ATL-HPA049139)

Atlas Antibodies

SKU:
ATL-HPA049139-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleoplasm, plasma membrane & vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 510
Gene Name: ZNF510
Alternative Gene Name: KIAA0972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094786: 34%, ENSRNOG00000029336: 33%
Entrez Gene ID: 22869
Uniprot ID: Q9Y2H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIEENPLVSNDRTQTWVKSSEYHENKKS
Gene Sequence FDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIEENPLVSNDRTQTWVKSSEYHENKKS
Gene ID - Mouse ENSMUSG00000094786
Gene ID - Rat ENSRNOG00000029336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF510 pAb (ATL-HPA049139)
Datasheet Anti ZNF510 pAb (ATL-HPA049139) Datasheet (External Link)
Vendor Page Anti ZNF510 pAb (ATL-HPA049139) at Atlas Antibodies

Documents & Links for Anti ZNF510 pAb (ATL-HPA049139)
Datasheet Anti ZNF510 pAb (ATL-HPA049139) Datasheet (External Link)
Vendor Page Anti ZNF510 pAb (ATL-HPA049139)