Anti ZNF507 pAb (ATL-HPA049728)

Atlas Antibodies

SKU:
ATL-HPA049728-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 507
Gene Name: ZNF507
Alternative Gene Name: KIAA1084
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044452: 84%, ENSRNOG00000013565: 86%
Entrez Gene ID: 22847
Uniprot ID: Q8TCN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVDCSYPIFENENEPLGLLDSSAAAAPGGVDAVVIAIGESELSIHNGPSVQVQICSSEQLSSSSPLEQSAERGVHLSQSVTLDPN
Gene Sequence EVDCSYPIFENENEPLGLLDSSAAAAPGGVDAVVIAIGESELSIHNGPSVQVQICSSEQLSSSSPLEQSAERGVHLSQSVTLDPN
Gene ID - Mouse ENSMUSG00000044452
Gene ID - Rat ENSRNOG00000013565
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF507 pAb (ATL-HPA049728)
Datasheet Anti ZNF507 pAb (ATL-HPA049728) Datasheet (External Link)
Vendor Page Anti ZNF507 pAb (ATL-HPA049728) at Atlas Antibodies

Documents & Links for Anti ZNF507 pAb (ATL-HPA049728)
Datasheet Anti ZNF507 pAb (ATL-HPA049728) Datasheet (External Link)
Vendor Page Anti ZNF507 pAb (ATL-HPA049728)