Anti ZNF500 pAb (ATL-HPA057963)

Atlas Antibodies

SKU:
ATL-HPA057963-25
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 500
Gene Name: ZNF500
Alternative Gene Name: KIAA0557, ZKSCAN18, ZSCAN50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038456: 32%, ENSRNOG00000014230: 30%
Entrez Gene ID: 26048
Uniprot ID: O60304
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEPRCMDPAQRDAPLENEGPGIQLEDGGDGREDAPLRMEWYRVLSARCQGPGHPLPGQRPAPVRGLVRPDQPRG
Gene Sequence EEPRCMDPAQRDAPLENEGPGIQLEDGGDGREDAPLRMEWYRVLSARCQGPGHPLPGQRPAPVRGLVRPDQPRG
Gene ID - Mouse ENSMUSG00000038456
Gene ID - Rat ENSRNOG00000014230
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF500 pAb (ATL-HPA057963)
Datasheet Anti ZNF500 pAb (ATL-HPA057963) Datasheet (External Link)
Vendor Page Anti ZNF500 pAb (ATL-HPA057963) at Atlas Antibodies

Documents & Links for Anti ZNF500 pAb (ATL-HPA057963)
Datasheet Anti ZNF500 pAb (ATL-HPA057963) Datasheet (External Link)
Vendor Page Anti ZNF500 pAb (ATL-HPA057963)