Anti ZNF487 pAb (ATL-HPA037820)

Atlas Antibodies

Catalog No.: ATL-HPA037820-25

Protein Description: zinc finger protein 487
Gene Name: ZNF487
Alternative Gene Name: KRBO1, ZNF487P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056824: 34%, ENSRNOG00000031478: 34%
Entrez Gene ID:
Uniprot ID: B1APH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVVCKLEHGQVLWILEEESPSQSHLDCCIDDDLMEKRQENQDQHLQKVDFVNNKTLTMDRNGVLGKTFSLDTNPILSRKIRGNCDSSG
• Gene Sequence: EVVCKLEHGQVLWILEEESPSQSHLDCCIDDDLMEKRQENQDQHLQKVDFVNNKTLTMDRNGVLGKTFSLDTNPILSRKIRGNCDSSG
• Gene ID - Mouse: ENSMUSG00000056824
• Gene ID - Rat: ENSRNOG00000031478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.