Anti ZNF485 pAb (ATL-HPA059356)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059356-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ZNF485
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032480: 29%, ENSRNOG00000029194: 29%
Entrez Gene ID: 220992
Uniprot ID: Q8NCK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AEPWTEVREAPSGTHAVEDYWFETKMSALKQSTSEASVLGERTKSVMMEKGLDWEGRSSTEK |
| Gene Sequence | AEPWTEVREAPSGTHAVEDYWFETKMSALKQSTSEASVLGERTKSVMMEKGLDWEGRSSTEK |
| Gene ID - Mouse | ENSMUSG00000032480 |
| Gene ID - Rat | ENSRNOG00000029194 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZNF485 pAb (ATL-HPA059356) | |
| Datasheet | Anti ZNF485 pAb (ATL-HPA059356) Datasheet (External Link) |
| Vendor Page | Anti ZNF485 pAb (ATL-HPA059356) at Atlas Antibodies |
| Documents & Links for Anti ZNF485 pAb (ATL-HPA059356) | |
| Datasheet | Anti ZNF485 pAb (ATL-HPA059356) Datasheet (External Link) |
| Vendor Page | Anti ZNF485 pAb (ATL-HPA059356) |