Anti ZNF480 pAb (ATL-HPA042218)

Atlas Antibodies

Catalog No.:
ATL-HPA042218-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 480
Gene Name: ZNF480
Alternative Gene Name: MGC32104
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019027: 32%, ENSRNOG00000013465: 33%
Entrez Gene ID: 147657
Uniprot ID: Q8WV37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSFHLHLSELELFPDERVINGCNQVENFINHSSSVSCLQEMSSSVK
Gene Sequence VSFHLHLSELELFPDERVINGCNQVENFINHSSSVSCLQEMSSSVK
Gene ID - Mouse ENSMUSG00000019027
Gene ID - Rat ENSRNOG00000013465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZNF480 pAb (ATL-HPA042218)
Datasheet Anti ZNF480 pAb (ATL-HPA042218) Datasheet (External Link)
Vendor Page Anti ZNF480 pAb (ATL-HPA042218) at Atlas Antibodies

Documents & Links for Anti ZNF480 pAb (ATL-HPA042218)
Datasheet Anti ZNF480 pAb (ATL-HPA042218) Datasheet (External Link)
Vendor Page Anti ZNF480 pAb (ATL-HPA042218)